PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV22153.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family NAC
Protein Properties Length: 241aa    MW: 27558 Da    PI: 6.3048
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV22153.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.77.6e-4351352127
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkklel.eevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                 +pGfrF Pt+eelv++yL+ ++e +kle+ ++vi+ v+iy++ePw+Lpk     +++++++w+fF+++++++a+  r+nr+t++gyWkatg+  +v+++
  KZV22153.1   5 APGFRFYPTEEELVSFYLRSQLELEKLETiNRVIPPVQIYQFEPWQLPKqcgeLCQGDTEQWFFFVPKKENEARRGRPNRTTATGYWKATGSPSHVHAA 103
                 69***********************97762556***************646654445777*************************************** PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                 +g+ +g+k+++vfykg+a +g+kt+W m+ey+
  KZV22153.1 104 DGKSIGVKRSMVFYKGKAGSGRKTKWKMNEYT 135
                 *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-433159IPR003441NAC domain
PROSITE profilePS5100545.1634160IPR003441NAC domain
PfamPF023651.6E-226135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEEIAPGFRF YPTEEELVSF YLRSQLELEK LETINRVIPP VQIYQFEPWQ LPKQCGELCQ  60
GDTEQWFFFV PKKENEARRG RPNRTTATGY WKATGSPSHV HAADGKSIGV KRSMVFYKGK  120
AGSGRKTKWK MNEYTAIVQD SNTTVPKLRD EMSLCRVYIV SGSLRAFDRR PTTPGETSRG  180
KINIAVENGT EVLHVSRDEN SGDKNRSIGE TSNQLLECNK ENGGYEDMMF GLENLLELEW  240
E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-31415817163NO APICAL MERISTEM PROTEIN
1ut4_B9e-31415817163NO APICAL MERISTEM PROTEIN
1ut7_A9e-31415817163NO APICAL MERISTEM PROTEIN
1ut7_B9e-31415817163NO APICAL MERISTEM PROTEIN
3swm_A1e-30415820166NAC domain-containing protein 19
3swm_B1e-30415820166NAC domain-containing protein 19
3swm_C1e-30415820166NAC domain-containing protein 19
3swm_D1e-30415820166NAC domain-containing protein 19
3swp_A1e-30415820166NAC domain-containing protein 19
3swp_B1e-30415820166NAC domain-containing protein 19
3swp_C1e-30415820166NAC domain-containing protein 19
3swp_D1e-30415820166NAC domain-containing protein 19
4dul_A9e-31415817163NAC domain-containing protein 19
4dul_B9e-31415817163NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838527.19e-91PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR32e-76NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A022RAV31e-90A0A022RAV3_ERYGU; Uncharacterized protein (Fragment)
STRINGSolyc11g068620.1.18e-86(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-77NAC domain containing protein 90